PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000265114
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 327aa    MW: 37122.4 Da    PI: 8.3781
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000265114genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.5e-1860105147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ede+l ++v+++G+++W++Ia++++ gR++k+c++rw++ 
    MDP0000265114  60 RGHWRPAEDEKLRELVERYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 105
                      899*****************************.***********996 PP

2Myb_DNA-binding53.65.3e-17112155146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
    MDP0000265114 112 RNPFTEEEEERLLVSHRIHGNR-WAVIARLFP-GRTDNAVKNHWHV 155
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.20355106IPR017930Myb domain
SMARTSM007172.9E-1559108IPR001005SANT/Myb domain
SuperFamilySSF466893.56E-2960153IPR009057Homeodomain-like
PfamPF002491.4E-1760105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-2761113IPR009057Homeodomain-like
CDDcd001673.31E-1463104No hitNo description
PROSITE profilePS5129423.321107161IPR017930Myb domain
SMARTSM007176.3E-15111159IPR001005SANT/Myb domain
PfamPF002493.0E-14112154IPR001005SANT/Myb domain
CDDcd001671.41E-11114154No hitNo description
Gene3DG3DSA:1.10.10.602.5E-20114160IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MVSDSPRAVG VVSQDVASIA GVSSTIIIVS VVIALPLRST SSSSSSSSSS SLLSAIMCTR  60
GHWRPAEDEK LRELVERYGP HNWNAIAEKL QGRSGKSCRL RWFNQLDPRI NRNPFTEEEE  120
ERLLVSHRIH GNRWAVIARL FPGRTDNAVK NHWHVIMARR CRERSRLNHS KLIRNTSSIT  180
AQTSFMSIIT NNNEPKSSSK QDHPLQINCD IGTWNLDSYN YIGKYYSCSD RNYHQYRPAF  240
THNPPPFPKE FYPNTCSVTM HQDHNKHQPI EFYDFLQVNT ESNGSEVIDN ARKDEEEVDQ  300
EGMGQQKSTV TGLPFINFLA VNNGTSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-32571601104C-Myb DNA-Binding Domain
1msf_C2e-32571601104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008393477.10.0PREDICTED: transcriptional activator Myb
TrEMBLA0A0H4CRL41e-115A0A0H4CRL4_BETPL; MYB transcription factor 3
STRINGPOPTR_0012s03650.11e-107(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-87myb domain protein 52